PDB entry 2hba

View 2hba on RCSB PDB site
Description: Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
Class: RNA binding protein
Keywords: L9, ribosomal protein, NTL9, K12M, RNA BINDING PROTEIN
Deposited on 2006-06-14, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L9
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: rplI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02417 (0-51)
      • engineered (11)
    Domains in SCOPe 2.08: d2hbaa1
  • Chain 'B':
    Compound: 50S ribosomal protein L9
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: rplI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02417 (0-51)
      • engineered (11)
    Domains in SCOPe 2.08: d2hbab1
  • Heterogens: ZN, CL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hbaA (A:)
    mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hbaB (B:)
    mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq