PDB entry 2hb4

View 2hb4 on RCSB PDB site
Description: Structure of HIV Protease NL4-3 in an Unliganded State
Class: hydrolase
Keywords: HIV, protease, aspartyl, retrovirus, HYDROLASE
Deposited on 2006-06-13, released 2007-06-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
    Domains in SCOPe 2.04: d2hb4a_
  • Heterogens: MG, PGR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hb4A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf