PDB entry 2haz
View 2haz on RCSB PDB site
Description: Crystal structure of the first fibronectin domain of human NCAM1
Class: cell adhesion
Keywords: fibronectin type III repeat, FN1, NCAM, beta sandwich, CELL ADHESION
Deposited on
2006-06-13, released
2006-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Neural cell adhesion molecule 1
Species: Homo sapiens [TaxId:9606]
Gene: NCAM1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2haza1 - Heterogens: NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2hazA (A:)
gshmdtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydak
easmegivtivglkpettyavrlaalngkglgeisaasefktqpv
Sequence, based on observed residues (ATOM records): (download)
>2hazA (A:)
shmdtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydake
asmegivtivglkpettyavrlaalngkglgeisaasefktqpv