PDB entry 2haz

View 2haz on RCSB PDB site
Description: Crystal structure of the first fibronectin domain of human NCAM1
Class: cell adhesion
Keywords: fibronectin type III repeat, FN1, NCAM, beta sandwich, CELL ADHESION
Deposited on 2006-06-13, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13592 (Start-104)
      • cloning artifact (1-3)
    Domains in SCOPe 2.08: d2haza1, d2haza2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hazA (A:)
gshmdtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydak
easmegivtivglkpettyavrlaalngkglgeisaasefktqpv

    Sequence, based on observed residues (ATOM records): (download) 
    >2hazA (A:)
shmdtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydake
asmegivtivglkpettyavrlaalngkglgeisaasefktqpv