PDB entry 2hax

View 2hax on RCSB PDB site
Description: Crystal structure of Bacillus caldolyticus cold shock protein in complex with hexathymidine
Class: gene regulation/DNA
Keywords: gene-expression regulator, beta barrel, protein-DNA complex, single-stranded DNA
Deposited on 2006-06-13, released 2007-04-24
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.132
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus
    Gene: cspB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2haxa1
  • Chain 'B':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus
    Gene: cspB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2haxb1
  • Chain 'C':
    Compound: 5'-d(*tp*tp*tp*tp*tp*t)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*tp*tp*tp*tp*tp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2haxA (A:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2haxB (B:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.