PDB entry 2hav

View 2hav on RCSB PDB site
Description: Apo-Human Serum Transferrin (Glycosylated)
Class: Metal Transport
Keywords: Serotransferrin, human, iron transporter, apo, iron-free, Metal Transport
Deposited on 2006-06-13, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hava1
  • Chain 'B':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2havb1
  • Heterogens: CIT, GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2havA (A:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeaptdeckpvkwcalshherlkcdewsvnsv
    gkiecvsaettedciakimngeadamsldggfvyiagkcglvpvlaenynksdncedtpe
    agyfavavvkksasdltwdnlkgkkschtavgrtagwnipmgllynkinhcrfdeffseg
    capgskkdsslcklcmgsglnlcepnnkegyygytgafrclvekgdvafvkhqtvpqntg
    gknpdpwaknlnekdyellcldgtrkpveeyanchlarapnhavvtrkdkeacvhkilrq
    qqhlfgsnvtdcsgnfclfrsetkdllfrddtvclaklhdrntyekylgeeyvkavgnlr
    kcstsslleactfrrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2havB (B:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeaptdeckpvkwcalshherlkcdewsvnsv
    gkiecvsaettedciakimngeadamsldggfvyiagkcglvpvlaenynksdncedtpe
    agyfavavvkksasdltwdnlkgkkschtavgrtagwnipmgllynkinhcrfdeffseg
    capgskkdsslcklcmgsglnlcepnnkegyygytgafrclvekgdvafvkhqtvpqntg
    gknpdpwaknlnekdyellcldgtrkpveeyanchlarapnhavvtrkdkeacvhkilrq
    qqhlfgsnvtdcsgnfclfrsetkdllfrddtvclaklhdrntyekylgeeyvkavgnlr
    kcstsslleactfrrp