PDB entry 2hah

View 2hah on RCSB PDB site
Description: The structure of FIV 12S protease in complex with TL-3
Class: hydrolase/hydrolase inhibitor
Keywords: retroviral, protease, aspartyl, feline, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2006-06-12, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Feline immunodeficiency virus (isolate Petaluma) [TaxId:11674]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-115)
      • engineered (36)
      • engineered (54-56)
      • engineered (58)
      • engineered (61-62)
      • engineered (96-100)
    Domains in SCOPe 2.06: d2haha_
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hahA (A:)
ynkvgttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmiggig
gfirgtnyinvhleirdenyktqcifgnvcvlednstpvnilgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >2hahA (A:)
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmiggiggfir
gtnyinvhleirdenyktqcifgnvcvlednstpvnilgrdnmikfnirlvm