PDB entry 2hag

View 2hag on RCSB PDB site
Description: Crystal structure of putative melanin biosynthesis protein TyrA (np_716371.1) from Shewanella oneidensis at 2.75 A resolution
Class: structural genomics, unknown function
Keywords: np_716371.1, putative melanin biosynthesis protein TyrA, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-06-12, released 2006-08-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Melanin biosynthesis protein TyrA, putative
    Species: Shewanella oneidensis
    Gene: np_716371.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EIU4 (Start-311)
      • modified residue (6)
      • modified residue (25)
      • modified residue (81)
      • modified residue (88)
      • modified residue (124)
      • modified residue (141)
      • modified residue (245)
      • modified residue (256)
      • modified residue (270)
      • modified residue (274)
      • modified residue (287)
      • modified residue (307)
    Domains in SCOP 1.73: d2haga1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hagA (A:)
    gmdiqnmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsaf
    ngfvaiganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvan
    eisqmfedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsy
    ihvqkyahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksie
    ilrqsmpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssff
    apsldflmqfdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hagA (A:)
    nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
    iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
    fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
    yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
    mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
    flmqfdn