PDB entry 2hag

View 2hag on RCSB PDB site
Description: Crystal structure of a putative dyp-type peroxidase protein (so_0740) from shewanella oneidensis at 2.75 A resolution
Class: hydrolase
Keywords: Ferredoxin-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2006-06-12, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Melanin biosynthesis protein TyrA, putative
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: np_716371.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EIU4 (Start-311)
      • modified residue (6)
      • modified residue (25)
      • modified residue (81)
      • modified residue (88)
      • modified residue (124)
      • modified residue (141)
      • modified residue (245)
      • modified residue (256)
      • modified residue (270)
      • modified residue (274)
      • modified residue (287)
      • modified residue (307)
    Domains in SCOPe 2.08: d2haga1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hagA (A:)
    gmdiqnmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsaf
    ngfvaiganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvan
    eisqmfedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsy
    ihvqkyahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksie
    ilrqsmpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssff
    apsldflmqfdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hagA (A:)
    nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
    iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
    fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
    yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
    mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
    flmqfdn