PDB entry 2haf

View 2haf on RCSB PDB site
Description: Crystal structure of a putative translation repressor from Vibrio cholerae
Class: translation repressor
Keywords: alpha/beta, X-ray Crystallography, Translation repressor, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2006-06-12, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.241
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative translation repressor
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KUP8 (15-End)
      • cloning artifact (7-14)
    Domains in SCOPe 2.07: d2hafa1, d2hafa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hafA (A:)
    mslsnhssdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapidi
    tvggmlkqvdiepaypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiav
    ttskdiltvlgteaepegyivalgysgwsagqleveltenswltieadpelifntpvhek
    wqkaiqklgispaqlssdagheggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hafA (A:)
    sdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlk
    qvdiepaypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdil
    tvlgteaepegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqk
    lgisp