PDB entry 2hae

View 2hae on RCSB PDB site
Description: Crystal structure of a putative malic enzyme (malate oxidoreductase)
Class: oxidoreductase
Keywords: HYPOTHETICAL PROTEIN, PUTATIVE MALIC ENZYME, MALATE:NAD+ OXIDOREDUCTASE, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2006-06-12, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.242
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate oxidoreductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (3-377)
      • see remark 999 (7)
    Domains in SCOPe 2.06: d2haea1, d2haea2
  • Chain 'B':
    Compound: Malate oxidoreductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (3-377)
      • see remark 999 (7)
    Domains in SCOPe 2.06: d2haeb1, d2haeb2
  • Chain 'C':
    Compound: Malate oxidoreductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (3-377)
      • see remark 999 (7)
    Domains in SCOPe 2.06: d2haec1, d2haec2
  • Chain 'D':
    Compound: Malate oxidoreductase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (3-377)
      • see remark 999 (7)
    Domains in SCOPe 2.06: d2haed1, d2haed2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2haeA (A:)
    msldalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwn
    tvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivks
    lepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekki
    eevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnp
    erlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareaga
    fivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipe
    afdmkvhlnvytavkgsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2haeA (A:)
    dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
    vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
    sfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkieev
    kvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyeiaritnperlsg
    dletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagafivat
    grsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipeafdmk
    vhlnvytavkgsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2haeB (B:)
    msldalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwn
    tvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivks
    lepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekki
    eevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnp
    erlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareaga
    fivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipe
    afdmkvhlnvytavkgsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2haeB (B:)
    dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
    vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
    sfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkieev
    kvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyeiaritnperlsg
    dletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagafivat
    grsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipeafdmk
    vhlnvytavkgsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2haeC (C:)
    msldalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwn
    tvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivks
    lepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekki
    eevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnp
    erlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareaga
    fivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipe
    afdmkvhlnvytavkgsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2haeC (C:)
    dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
    vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
    sfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkieev
    kvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyeiaritnperlsg
    dletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagafivat
    grsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipeafdmk
    vhlnvytavkgsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2haeD (D:)
    msldalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwn
    tvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivks
    lepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekki
    eevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnp
    erlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareaga
    fivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipe
    afdmkvhlnvytavkgsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2haeD (D:)
    dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
    vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
    sfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkieev
    kvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyeiaritnperlsg
    dletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagafivat
    grsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipeafdmk
    vhlnvytavkgsa