PDB entry 2h9w

View 2h9w on RCSB PDB site
Description: Green fluorescent protein ground states: the influence of a second protonation site near the chromophore
Class: luminescent protein
Keywords: GFP, CHROMOPHORE, MUTANT, FLUORESCENT, pH, BIOSENSOR, CHLORIDE, HALIDE, HALOGEN, LUMINESCENT PROTEIN
Deposited on 2006-06-12, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.167
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (4-239)
      • cloning artifact (0-3)
      • engineered (66)
      • chromophore (68)
      • engineered (205)
      • engineered (233)
    Domains in SCOPe 2.06: d2h9wa1, d2h9wa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h9wA (A:)
    pftvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpw
    ptlvttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegd
    tlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvq
    ladhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdely