PDB entry 2h9r

View 2h9r on RCSB PDB site
Description: Docking and dimerization domain (D/D) of the regulatory subunit of the Type II-alpha cAMP-dependent protein kinase A associated with a Peptide derived from an A-kinase anchoring protein (AKAP)
Class: transferase
Keywords: AKAP, PKA, NMR, signal transduction, 4-helix bundle, helix-loop-helix, protein-peptide complex, TRANSFERASE
Deposited on 2006-06-10, released 2006-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12368 (3-45)
      • see remark 999 (0-2)
    Domains in SCOPe 2.05: d2h9ra1
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RIIA(1-44)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12368 (3-45)
      • see remark 999 (0-2)
    Domains in SCOPe 2.05: d2h9rb1
  • Chain 'C':
    Compound: 22-mer from A-kinase anchor protein 5
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h9rA (A:)
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h9rB (B:)
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

  • Chain 'C':
    No sequence available.