PDB entry 2h9i

View 2h9i on RCSB PDB site
Description: Mycobacterium tuberculosis InhA bound with ETH-NAD adduct
Class: oxidoreductase
Keywords: InhA, ethionamide, ETH, tuberculosis, OXIDOREDUCTASE
Deposited on 2006-06-09, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y6 (1-267)
      • engineered (0)
    Domains in SCOPe 2.06: d2h9ia_
  • Heterogens: EAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h9iA (A:)
    aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll