PDB entry 2h9g

View 2h9g on RCSB PDB site
Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
Class: immune system/apoptosis
Keywords: PHAGE DISPLAY, PROTEIN ENGINEERING, COMBINATORIAL MUTAGENESIS, ANTIBODY LIBRARY, DEATH RECEPTOR-5, agonists, IMMUNE SYSTEM-APOPTOSIS COMPLEX
Deposited on 2006-06-09, released 2006-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab BdF1, light chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H9G (0-End)
    Domains in SCOPe 2.07: d2h9ga1, d2h9ga2
  • Chain 'B':
    Compound: Fab BdF1, heavy chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H9G (0-End)
    Domains in SCOPe 2.07: d2h9gb1, d2h9gb2
  • Chain 'H':
    Compound: Fab BdF1, heavy chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H9G (0-End)
    Domains in SCOPe 2.07: d2h9gh1, d2h9gh2
  • Chain 'L':
    Compound: Fab BdF1, light chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H9G (0-End)
    Domains in SCOPe 2.07: d2h9gl1, d2h9gl2
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 10B precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF10B, DR5, KILLER, TRAILR2, TRICK2, ZTNFR9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h9gr1, d2h9gr2, d2h9gr3
  • Chain 'S':
    Compound: Tumor necrosis factor receptor superfamily member 10B precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF10B, DR5, KILLER, TRAILR2, TRICK2, ZTNFR9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h9gs1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h9gA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h9gB (B:)
    evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
    adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gB (B:)
    evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
    adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2h9gH (H:)
    evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
    adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gH (H:)
    evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
    adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2h9gL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2h9gR (R:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gR (R:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2h9gS (S:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9gS (S:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvc