PDB entry 2h9c

View 2h9c on RCSB PDB site
Description: Native Crystal Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aeruginosa
Class: lyase
Keywords: intertwinded dimer, LYASE
Deposited on 2006-06-09, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9ca_
  • Chain 'B':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9cb_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h9cA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9cA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfapervaamlperarwaeen
    gldapfveglfaqiihwyiaeqikywrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h9cB (B:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9cB (B:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfpapervaamlperarwaee
    ngldapfveglfaqiihwyiaeqik