PDB entry 2h94

View 2h94 on RCSB PDB site
Description: Crystal Structure and Mechanism of human Lysine-Specific Demethylase-1
Class: oxidoreductase
Keywords: Histone Demethylase
Deposited on 2006-06-08, released 2006-07-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific histone demethylase 1
    Species: HOMO SAPIENS
    Gene: AOF2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2h94a1, d2h94a2, d2h94a3
  • Heterogens: HG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h94A (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
    rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
    hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
    qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
    qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
    agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
    dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
    amyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h94A (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeastaefl
    vkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefa
    natplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasg
    ceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsavqrmgfgnl
    nkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagimenis
    ddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgndydlmaqp
    itpgiprlffagehtirnypatvhgallsglreagriadqflgamyt