PDB entry 2h92

View 2h92 on RCSB PDB site
Description: Crystal Structure of Staphylococcus aureus Cytidine Monophosphate Kinase in complex with cytidine-5'-monophosphate
Class: transferase
Keywords: Rossmann fold, TRANSFERASE
Deposited on 2006-06-08, released 2006-08-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h92a_
  • Chain 'B':
    Compound: Cytidylate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h92b_
  • Chain 'C':
    Compound: Cytidylate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h92c_
  • Heterogens: SO4, C5P, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h92A (A:)
    mkainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdq
    ttldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekg
    ivmdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqyd
    mnreisplrkaddavtldttgksieevtdeilamvsqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h92A (A:)
    ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
    ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
    mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
    reisplrkaddavtldttgksieevtdeilamvsqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h92B (B:)
    mkainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdq
    ttldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekg
    ivmdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqyd
    mnreisplrkaddavtldttgksieevtdeilamvsqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h92B (B:)
    ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
    ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
    mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
    reisplrkaddavtldttgksieevtdeilamvsqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h92C (C:)
    mkainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdq
    ttldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekg
    ivmdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqyd
    mnreisplrkaddavtldttgksieevtdeilamvsqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h92C (C:)
    ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
    ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
    mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
    reisplrkaddavtldttgksieevtdeilamvsqi