PDB entry 2h8w

View 2h8w on RCSB PDB site
Description: Solution structure of ribosomal protein L11
Class: RNA binding protein
Keywords: L11, antibiotics, ribosome, RNA BINDING PROTEIN
Deposited on 2006-06-08, released 2007-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2h8wa1, d2h8wa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8wA (A:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda