PDB entry 2h8w

View 2h8w on RCSB PDB site
Description: Solution structure of ribosomal protein L11
Class: RNA binding protein
Keywords: L11, antibiotics, ribosome
Deposited on 2006-06-08, released 2007-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-03, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2h8wa1, d2h8wa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h8wA (A:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda