PDB entry 2h8u

View 2h8u on RCSB PDB site
Description: Bucain, a cardiotoxin from the Malayan Krait Bungarus candidus
Class: toxin
Keywords: bucain, cardiotoxin, TOXIN
Deposited on 2006-06-08, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bucain
    Species: Bungarus candidus [TaxId:92438]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h8ua_
  • Chain 'B':
    Compound: Bucain
    Species: Bungarus candidus [TaxId:92438]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h8ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8uA (A:)
    rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
    dkcna
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8uB (B:)
    rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
    dkcna