PDB entry 2h8p

View 2h8p on RCSB PDB site
Description: Structure of a K channel with an amide to ester substitution in the selectivity filter
Class: membrane protein
Keywords: Channel, Semi-synthetic, Ester, MEMBRANE PROTEIN
Deposited on 2006-06-07, released 2006-09-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H8P (0-218)
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2H8P (0-211)
  • Chain 'C':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2h8pc1
  • Chain 'D':
    Compound: KcsA Channel
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2H8P (0-42)
    Domains in SCOPe 2.03: d2h8pd1
  • Heterogens: K, GOA, B3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8pC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8pD (D:)
    dlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerr