PDB entry 2h8i

View 2h8i on RCSB PDB site
Description: Crystal Structure of the Bothropstoxin-I complexed with polyethylene glycol
Class: toxin
Keywords: Lys49-PLA2s, myotoxicity, TOXIN
Deposited on 2006-06-07, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog 1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
    • variant see remark 999 (20)
    • see remark 999 (57)
    • see remark 999 (119)
  Domains in SCOPe 2.08: d2h8ia_
• Chain 'B':
  Compound: Phospholipase A2 homolog 1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
    • variant see remark 999 (20)
    • see remark 999 (57)
    • see remark 999 (119)
  Domains in SCOPe 2.08: d2h8ib_
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h8iA (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h8iB (B:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c