PDB entry 2h8h

View 2h8h on RCSB PDB site
Description: Src kinase in complex with a quinazoline inhibitor
Class: transferase
Keywords: src kinase, transferase
Deposited on 2006-06-07, released 2006-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h8ha1, d2h8ha2, d2h8ha3
  • Heterogens: H8H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h8hA (A:)
    gsnkskpkdasqrrrslepaenvhgagggafpasqtpskpasadghrgpsaafapaaaep
    klfggfnssdtvtspqragplaggvttfvalydyesrtetdlsfkkgerlqivnntegdw
    wlahslstgqtgyipsnyvapsdsiqaeewyfgkitrreserlllnaenprgtflvrese
    ttkgayclsvsdfdnakglnvkhykirkldsggfyitsrtqfnslqqlvayyskhadglc
    hrlttvcptskpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlk
    pgtmspeaflqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkyl
    rlpqlvdmaaqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneyta
    rqgakfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqverg
    yrmpcppecpeslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h8hA (A:)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsiq
    aeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweipr
    eslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklvq
    lyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyvh
    rdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiksd
    vwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepe
    erptfeylqafledyftstepqyqp