PDB entry 2h8f

View 2h8f on RCSB PDB site
Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2
Class: transport protein
Keywords: Root effect, pH, cooperativity, hemoglobin, allostery, high resolution
Deposited on 2006-06-07, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-10, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha subunit
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h8fa1
  • Chain 'B':
    Compound: Hemoglobin beta subunit
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h8fb1
  • Chain 'C':
    Compound: Hemoglobin alpha subunit
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h8fc1
  • Chain 'D':
    Compound: Hemoglobin beta subunit
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h8fd1
  • Heterogens: ACE, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8fA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8fB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8fC (C:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8fD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh