PDB entry 2h8d

View 2h8d on RCSB PDB site
Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 8.4
Class: transport protein
Keywords: Root effect, pH, cooperativity, hemoglobin, allostery, high resolution, TRANSPORT PROTEIN
Deposited on 2006-06-07, released 2006-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha subunit
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2h8da_
  • Chain 'B':
    Compound: Hemoglobin beta subunit
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2h8db_
  • Chain 'C':
    Compound: Hemoglobin alpha subunit
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2h8dc_
  • Chain 'D':
    Compound: Hemoglobin beta subunit
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2h8dd_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8dA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8dB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8dC (C:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h8dD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh