PDB entry 2h7z

View 2h7z on RCSB PDB site
Description: Crystal structure of irditoxin
Class: toxin
Keywords: three-finger toxin, neurotoxin, snake venom, toxin
Deposited on 2006-06-06, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Irditoxin subunit A
  Species: Boiga irregularis [TaxId:92519]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0S864 (0-74)
  Domains in SCOPe 2.08: d2h7za1
• Chain 'B':
  Compound: Irditoxin subunit B
  Species: Boiga irregularis [TaxId:92519]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0S865 (0-76)
  Domains in SCOPe 2.08: d2h7zb1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h7zA (A:)
  qavgppytlcfecnrmtssdcstalrcyrgscytlyrpdencelkwavkgcaetcptagp
  nervkccrsprcndd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h7zB (B:)
  qakgppytlcfecnretcsncfkdnrcppyhrtcytlyrpdgngemkwavkgcaktcpta
  qpgesvqccntpkcndy