PDB entry 2h7w

View 2h7w on RCSB PDB site
Description: Crystal structure of Chagasin, the endogenous cysteine-protease inhibitor from Trypanosoma cruzi
Class: hydrolase inhibitor
Keywords: beta-strands, Immunoglobulin-fold, HYDROLASE INHIBITOR
Deposited on 2006-06-05, released 2006-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cha
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q966X9 (Start-130)
      • variant (124)
    Domains in SCOPe 2.08: d2h7wa1
  • Chain 'B':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cha
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q966X9
      • variant (124)
    Domains in SCOPe 2.08: d2h7wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h7wA (A:)
    mgsshhhhhhssgenlyfqghmshkvtkahngatltvavgelveiqlpsnpttgfawyfe
    ggtkespnesmftvenkyfppdskllgaggtehfhvtvkaagthavnltymrpwtgpshd
    serfivylkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7wA (A:)
    hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
    kllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylkan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h7wB (B:)
    mgsshhhhhhssgenlyfqghmshkvtkahngatltvavgelveiqlpsnpttgfawyfe
    ggtkespnesmftvenkyfppdskllgaggtehfhvtvkaagthavnltymrpwtgpshd
    serfivylkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7wB (B:)
    shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
    skllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylka