PDB entry 2h7k

View 2h7k on RCSB PDB site
Description: Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961
Class: hydrolase
Keywords: L-asparaginase I, SAD, MCSG, Structural Genomics , PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2006-06-02, released 2006-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2007-01-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase I
    Species: Vibrio cholerae O1 biovar eltor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h7ka_
  • Chain 'B':
    Compound: L-asparaginase I
    Species: Vibrio cholerae O1 biovar eltor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h7kb_
  • Chain 'C':
    Compound: L-asparaginase I
    Species: Vibrio cholerae O1 biovar eltor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h7kc_
  • Chain 'D':
    Compound: L-asparaginase I
    Species: Vibrio cholerae O1 biovar eltor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h7kd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h7kA (A:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7kA (A:)
    arkhiyiaytggtigmkksvpvagfmekqlasmpefhrpemplftiheydplmdssdmtp
    adwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlr
    sdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggcaladagvisgydmtpeaalak
    lhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h7kB (B:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7kB (B:)
    arkhiyiaytggtigmkksvpvagfmekqlasmpefhrpemplftiheydplmdssdmtp
    adwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlr
    sdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvigydmtpeaa
    laklhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h7kC (C:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7kC (C:)
    arkhiyiaytggtigmkksyvpvagfmekqlasmpefhrpemplftiheydplmdssdmt
    padwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladl
    rsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshafsafsspnlpplleagin
    ielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgvg
    napqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydmtpeaa
    laklhyllsqnlsyeevkakmqqvlrgemtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h7kD (D:)
    markhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmds
    sdmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqip
    ladlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppl
    leaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamil
    ltfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgyd
    mtpeaalaklhyllsqnlsyeevkakmqqvlrgemtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h7kD (D:)
    arkhiyiaytggtigmkksvpvagfmekqlasmpefhrpemplftiheydplmdssdmtp
    adwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladlr
    sdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleagi
    nielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfgv
    gnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydmtpea
    alaklhyllsqnlsyeevkakmqqvlrgemtl