PDB entry 2h6u

View 2h6u on RCSB PDB site
Description: Crystal structure of 5-hydroxyisourate hydrolase (formerly known as TRP, transthyretin related protein)
Class: hydrolase
Keywords: 5-hydroxyisourate hydrolase, trp, uric acid degradation, allantoin, hydrolase
Deposited on 2006-06-01, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.225
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6ua_
  • Chain 'B':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6ub_
  • Chain 'C':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6uc_
  • Chain 'D':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6ud_
  • Chain 'E':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6ue_
  • Chain 'F':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6uf_
  • Chain 'G':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6ug_
  • Chain 'H':
    Compound: 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
    Species: Danio rerio [TaxId:7955]
    Gene: GeneID:558664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P422 (Start-118)
      • engineered (5)
    Domains in SCOPe 2.07: d2h6uh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6uA (A:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uA (A:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6uB (B:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uB (B:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h6uC (C:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uC (C:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h6uD (D:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uD (D:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2h6uE (E:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uE (E:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2h6uF (F:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uF (F:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2h6uG (G:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uG (G:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2h6uH (H:)
    maatllsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitke
    nfiagvykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6uH (H:)
    lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
    vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs