PDB entry 2h6t

View 2h6t on RCSB PDB site
Description: Secreted aspartic proteinase (Sap) 3 from Candida albicans complexed with pepstatin A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic proteinase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2006-06-01, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-3
    Species: Candida albicans [TaxId:5476]
    Gene: SAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h6ta_
  • Chain 'B':
    Compound: pepstatin A
    Database cross-references and differences (RAF-indexed):
    • PDB 2H6T (0-5)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h6tA (A:)
qtvpvklineqvsyasditvgsnkqkltvvidtgssdlwvpdsqvscqagqgqdpnfckn
egtyspssssssqnlnspfsieygdgttsqgtwykdtigfggisitkqqfadvtstsvdq
gilgigyktheaegnydnvpvtlknqgiisknayslylnsrqatsgqiifggvdnakysg
tlialpvtsdnelrihlntvkvagqsinadvdvlldsgttitylqqgvadqvisafngqe
tydangnlfylvdcnlsgsvdfafdknakisvpaseftaplytedgqvydqcqllfgtsd
ynilgdnflrsayivydlddneislaqvkyttasniaalt

  • Chain 'B':
    No sequence available.