PDB entry 2h6s

View 2h6s on RCSB PDB site
Description: Secreted aspartic proteinase (Sap) 3 from Candida albicans
Class: hydrolase
Keywords: aspartic proteinase, HYDROLASE
Deposited on 2006-06-01, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-3
    Species: Candida albicans [TaxId:5476]
    Gene: SAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h6sa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h6sA (A:)
    qtvpvklineqvsyasditvgsnkqkltvvidtgssdlwvpdsqvscqagqgqdpnfckn
    egtyspssssssqnlnspfsieygdgttsqgtwykdtigfggisitkqqfadvtstsvdq
    gilgigyktheaegnydnvpvtlknqgiisknayslylnsrqatsgqiifggvdnakysg
    tlialpvtsdnelrihlntvkvagqsinadvdvlldsgttitylqqgvadqvisafngqe
    tydangnlfylvdcnlsgsvdfafdknakisvpaseftaplytedgqvydqcqllfgtsd
    ynilgdnflrsayivydlddneislaqvkyttasniaalt