PDB entry 2h6r

View 2h6r on RCSB PDB site
Description: Crystal Structure of triosephosphate isomerase (TIM) from Methanocaldococcus jannaschii
Class: Isomerase
Keywords: beta-alpha barrel, Isomerase
Deposited on 2006-06-01, released 2007-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6ra_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rd_
  • Chain 'E':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6re_
  • Chain 'F':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rf_
  • Chain 'G':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rg_
  • Chain 'H':
    Compound: triosephosphate isomerase
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: TPIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58923 (0-End)
      • engineered (1)
      • engineered (133)
    Domains in SCOPe 2.01: d2h6rh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6rA (A:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rA (A:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppevvegtvravkeinkdvkvlcgagiskgedvkaaldlgae
    gvllasgvvkaknveeairelik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6rB (B:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rB (B:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppelianpevvegtvravkeinkdvkvlcgagiskgedvkaa
    ldlgaegvllasgvvkaknveeairelik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h6rC (C:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rC (C:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciavepppevvegtvravkeinkdvkvlcgagiskgedvkaaldlga
    egvllasgvvkaknveeairelik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h6rD (D:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rD (D:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciavevvegtvravkeinkdvkvlcgagiskgedvkaaldlgaegvl
    lasgvvkaknveeairelik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2h6rE (E:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rE (E:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppanpevvegtvravkeinkdvkvlcgagiskgedvkaaldl
    gaegvllasgvvkaknveeairelikf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2h6rF (F:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rF (F:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppvegtvravkeinkdvkvlcgagiskgedvkaaldlgaegv
    llasgvvkaknveeairelik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2h6rG (G:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rG (G:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppegtvravkeinkdvkvlcgagiskgedvkaaldlgaegvl
    lasgvvkaknveeairelik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2h6rH (H:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
    kgedvkaaldlgaegvllasgvvkaknveeairelikfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6rH (H:)
    mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
    idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
    intskavaalspdciavevvegtvravkeinkdvkvlcgagiskgedvkaaldlgaegvl
    lasgvvkaknveeairelikf