PDB entry 2h6l

View 2h6l on RCSB PDB site
Description: X-Ray Crystal Structure of the Metal-containing Protein AF0104 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium Target GR103.
Class: structural genomics, unknown function
Keywords: X-Ray structure NESG GR103, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-05-31, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30132 (0-137)
      • modified residue (0)
      • modified residue (66)
      • modified residue (80)
      • expression tag (138-139)
    Domains in SCOPe 2.07: d2h6la1, d2h6la2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30132 (0-137)
      • modified residue (0)
      • modified residue (66)
      • modified residue (80)
      • expression tag (138-139)
    Domains in SCOPe 2.07: d2h6lb2, d2h6lb3
  • Chain 'C':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30132 (0-137)
      • modified residue (0)
      • modified residue (66)
      • modified residue (80)
      • expression tag (138-139)
    Domains in SCOPe 2.07: d2h6lc2, d2h6lc3
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6lA (A:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6lA (A:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6lB (B:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6lB (B:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h6lC (C:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6lC (C:)
    mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
    yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
    sgeaperafdeqtglflwle