PDB entry 2h6j

View 2h6j on RCSB PDB site
Description: Crystal Structure of the Beta F145A Rhodococcus Proteasome (CASP Target)
Class: hydrolase
Keywords: 20S proteasome, half proteasome, assembly-dependent activation
Deposited on 2006-05-31, released 2006-08-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.262
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6ja1
  • Chain 'B':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6jb1
  • Chain 'C':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6jc1
  • Chain 'D':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6jd1
  • Chain 'E':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6je1
  • Chain 'F':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6jf1
  • Chain 'G':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h6jg1
  • Chain 'H':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'I':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'J':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'K':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'L':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'M':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Chain 'N':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis
    Gene: prcB 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53079
      • engineered (209)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6jA (A:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jA (A:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6jB (B:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jB (B:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h6jC (C:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jC (C:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h6jD (D:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jD (D:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2h6jE (E:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jE (E:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2h6jF (F:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jF (F:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2h6jG (G:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6jG (G:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.