PDB entry 2h6h

View 2h6h on RCSB PDB site
Description: Y365F Protein Farnesyltransferase Mutant Complexed with a Farnesylated DDPTASACVLS Peptide Product at 1.8A
Class: transferase
Keywords: FTase, farnesyltransferase, farnesyl transferase, prenyltransferase, CaaX, Ras, lipid modification, prenylation, substrate selectivity
Deposited on 2006-05-31, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: HOMO SAPIENS
    Gene: Human FTase alpha subunit
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2h6ha1
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: HOMO SAPIENS
    Gene: Human FTase beta subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49356
      • engineered (364)
    Domains in SCOP 1.75: d2h6hb1
  • Chain 'P':
    Compound: farnesylated peptide
    Species: synthetic, synthetic
  • Heterogens: SUC, ZN, FAR, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6hA (A:)
    maategvgeaaqggepgqpaqpppqphppppqqqhkeemaaeageavaspmddgfvslds
    psyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrvlvewlr
    dpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnnsvwnqr
    yfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhstendsptnvqqeef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6hA (A:)
    fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
    lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
    svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6hB (B:)
    maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcfclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
    pgfeelkdetsaepatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6hB (B:)
    sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
    rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
    speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
    vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
    glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
    lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcfclsglsiaq
    hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
    

  • Chain 'P':
    No sequence available.