PDB entry 2h61

View 2h61 on RCSB PDB site
Description: X-ray structure of human Ca2+-loaded S100B
Class: metal binding protein, signaling protein
Keywords: S100, EF-hand, Calcium-binding, RAGE, METAL BINDING PROTEIN, SIGNALING PROTEIN
Deposited on 2006-05-30, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h61a_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h61b_
  • Chain 'C':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04271 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d2h61c_
  • Chain 'D':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04271 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d2h61d_
  • Chain 'E':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h61e_
  • Chain 'F':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h61f_
  • Chain 'G':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04271 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d2h61g_
  • Chain 'H':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h61h_
  • Heterogens: CA, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h61A (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61A (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h61B (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h61C (C:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61C (C:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h61D (D:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61D (D:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2h61E (E:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61E (E:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2h61F (F:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61F (F:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2h61G (G:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61G (G:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2h61H (H:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h61H (H:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffe