PDB entry 2h5k

View 2h5k on RCSB PDB site
Description: Crystal Structure of Complex Between the Domain-Swapped Dimeric Grb2 SH2 Domain and Shc-Derived Ligand, Ac-NH-pTyr-Val-Asn-NH2
Class: hormone/growth factor
Keywords: Domain-swapping, protein-phosphopeptide complex, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2006-05-26, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h5ka1
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h5kb1
  • Chain 'C':
    Compound: Shc-Derived Ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2H5K
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2h5kA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2h5kA (A:)
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2h5kB (B:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2h5kB (B:)
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

  • Chain 'C':
    No sequence available.