PDB entry 2h59

View 2h59 on RCSB PDB site
Description: Sir2 H116A-deacetylated p53 peptide-3'-o-acetyl ADP ribose
Class: Hydrolase
Keywords: Rossmann fold, Zn binding domain, Hydrolase
Deposited on 2006-05-25, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYW0 (0-245)
      • engineered (115)
    Domains in SCOPe 2.07: d2h59a_
  • Chain 'B':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYW0 (0-245)
      • engineered (115)
    Domains in SCOPe 2.07: d2h59b_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, APR, 3OD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h59A (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielagnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h59B (B:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielagnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.