PDB entry 2h4u

View 2h4u on RCSB PDB site
Description: Crystal Structure of Human Thioesterase Superfamily Member 2 (CASP Target)
Class: hydrolase
Keywords: THIOESTERASE, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
Deposited on 2006-05-25, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h4ua1
  • Chain 'B':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h4ub_
  • Chain 'C':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h4uc_
  • Chain 'D':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3 (23-End)
      • cloning artifact (14-22)
    Domains in SCOPe 2.06: d2h4ud2, d2h4ud3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h4uA (A:)
    mhhhhhhssgvdlgtenlyfqsmrnfervlgkitlvsaapgkvicemkveeehtnaigtl
    hggltatlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaf
    tsvdltnkatgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4uA (A:)
    rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg
    apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h4uB (B:)
    mhhhhhhssgvdlgtenlyfqsmrnfervlgkitlvsaapgkvicemkveeehtnaigtl
    hggltatlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaf
    tsvdltnkatgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4uB (B:)
    rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg
    apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl
    g
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h4uC (C:)
    mhhhhhhssgvdlgtenlyfqsmrnfervlgkitlvsaapgkvicemkveeehtnaigtl
    hggltatlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaf
    tsvdltnkatgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4uC (C:)
    rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg
    apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl
    g
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h4uD (D:)
    mhhhhhhssgvdlgtenlyfqsmrnfervlgkitlvsaapgkvicemkveeehtnaigtl
    hggltatlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaf
    tsvdltnkatgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4uD (D:)
    tenlyfqsmrnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnist
    mallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkli
    aqgrhtkhlg