PDB entry 2h4m

View 2h4m on RCSB PDB site
Description: Karyopherin Beta2/Transportin-M9NLS
Class: protein transport
Keywords: HEAT Repeat, Nuclear import complex, PROTEIN TRANSPORT
Deposited on 2006-05-24, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNPO1, KPNB2, MIP1, TRN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4ma_
  • Chain 'B':
    Compound: Transportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNPO1, KPNB2, MIP1, TRN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h4mb_
  • Chain 'C':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPA1, HNRPA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPA1, HNRPA1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h4mA (A:)
    meyewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklkse
    deptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiask
    gelqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkfl
    qffkhsspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralv
    mllevrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpkl
    ipvlvngmkysdidiillkgdveedetipdseqdiggsggsgdtisdwnlrkcsaaaldv
    lanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeliphliq
    clsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaacsafa
    tleeeactelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpeyiqml
    mppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktlaqaml
    nnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkmpevrq
    ssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmgiemqp
    yipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwctslrnir
    dneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgfknqvg
    denwrrfsdqfplplkerlaafygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4mA (A:)
    kpdeqglqqilqllkesqspdttiqrtvqqkpdfnnylifvltklksedeptrslsglil
    knnvkfqnfpngvtdfikseclnnigdsspliratvgilittiaskgelqnwpdllpklc
    slldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqffkhsspkirsha
    vacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmllevrmdrllphm
    hniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlvngmkysdid
    iillktisdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlga
    iaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmt
    ellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllilyd
    aigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgflp
    ycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlv
    arsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefis
    vcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvcp
    qevapmlqqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavaswi
    npkddlrdmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h4mB (B:)
    meyewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklkse
    deptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiask
    gelqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkfl
    qffkhsspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralv
    mllevrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpkl
    ipvlvngmkysdidiillkgdveedetipdseqdiggsggsgdtisdwnlrkcsaaaldv
    lanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeliphliq
    clsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaacsafa
    tleeeactelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpeyiqml
    mppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktlaqaml
    nnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkmpevrq
    ssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmgiemqp
    yipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwctslrnir
    dneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgfknqvg
    denwrrfsdqfplplkerlaafygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4mB (B:)
    kpdeqglqqilqllkesqspdttiqrtvqqkpdfnnylifvltsedeptrslsglilknn
    fqnfpngvtdfikseclnnigdsspliratvgilittiaskgelqnwpdllpklcsllds
    edyntcegafgalqkicedplnimipkflqffkhsspkirshavacvnqfiisrtqalml
    hidsfienlfalagdeepevrknvcralvmllevrmdrllphmhniveymlqrtqdqden
    valeacefwltlaeqpickdvlvrhlpklipvlvngmkysdidiillktisdwnlrkcsa
    aaldvlanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeli
    phliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaa
    csafatleeeactelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpe
    yiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktl
    aqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkm
    pevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmg
    iemqpyipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwcts
    lrnirdneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgf
    knqvgdenwrrfsdqfplplkerlaafygv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.