PDB entry 2h4e

View 2h4e on RCSB PDB site
Description: Crystal structure of Cys10 sulfonated transthyretin
Class: transport protein
Keywords: Amyloid, Sulfite, Transthyretin, Familial amyloidotic polyneuropathy, TRANSPORT PROTEIN
Deposited on 2006-05-24, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.184
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • modified residue (9)
    Domains in SCOPe 2.07: d2h4ea_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • modified residue (9)
    Domains in SCOPe 2.07: d2h4eb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h4eA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4eA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h4eB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4eB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn