PDB entry 2h46

View 2h46 on RCSB PDB site
Description: Native domain-swapped dimer crystal structure of the Grb2 SH2 domain
Class: hormone/growth factor
Keywords: helix-sheet-helix, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2006-05-23, released 2006-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Growth Receptor Binding Protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h46e_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >2h46E (E:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2h46E (E:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie