PDB entry 2h43

View 2h43 on RCSB PDB site
Description: Crystal Structure of Human Fragment D Complexed with Ala-His-Arg-Pro-amide
Class: blood clotting
Keywords: knob-hole interaction, fragment D, coiled-coil, BLOOD CLOTTING
Deposited on 2006-05-23, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h43a1
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h43d1
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: GLY-HIS-ARG-PRO-AMIDE peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2H43 (0-End)
  • Chain 'J':
    Compound: GLY-HIS-ARG-PRO-AMIDE peptide ligand
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2H43 (0-End)
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h43A (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h43A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviakdllp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h43D (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h43D (D:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviakdllp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.