PDB entry 2h43
View 2h43 on RCSB PDB site
Description: Crystal Structure of Human Fragment D Complexed with Ala-His-Arg-Pro-amide
Class: blood clotting
Keywords: knob-hole interaction, fragment D, coiled-coil, BLOOD CLOTTING
Deposited on
2006-05-23, released
2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: fibrinogen alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2h43a1 - Chain 'B':
Compound: fibrinogen beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Fibrinogen gamma chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: fibrinogen alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2h43d1 - Chain 'E':
Compound: fibrinogen beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Fibrinogen gamma chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: GLY-HIS-ARG-PRO-AMIDE peptide ligand
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: GLY-HIS-ARG-PRO-AMIDE peptide ligand
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2h43A (A:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr
Sequence, based on observed residues (ATOM records): (download)
>2h43A (A:)
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakdllp
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2h43D (D:)
vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
revdlkdyedqqkqleqviakdllpsr
Sequence, based on observed residues (ATOM records): (download)
>2h43D (D:)
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakdllp
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.