PDB entry 2h40

View 2h40 on RCSB PDB site
Description: Crystal structure of the catalytic domain of unliganded PDE5
Class: hydrolase
Keywords: PDE5, unliganded
Deposited on 2006-05-23, released 2006-06-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.221
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: HOMO SAPIENS
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h40a1
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h40A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h40A (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrekknkipsmqvgfidaiclqlyealthvsedcfplldgcrkn
    rqkwqalaeqq