PDB entry 2h3z

View 2h3z on RCSB PDB site
Description: Structure of the HIV-1 matrix protein bound to di-C4-phosphatidylinositol-(4,5)-bisphosphate
Class: viral protein
Keywords: HIV-1 unmyristoylated matrix protein, VIRAL PROTEIN
Deposited on 2006-05-23, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-130)
  Domains in SCOPe 2.07: d2h3za_
• Heterogens: PBU

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h3zA (A:)
  garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
  gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
  tgnnsqvsqny