PDB entry 2h3v

View 2h3v on RCSB PDB site
Description: Structure of the HIV-1 Matrix protein bound to di-C8-phosphatidylinositol-(4,5)-bisphosphate
Class: viral protein
Keywords: HIV-1 unmyristoylated MA protein, VIRAL PROTEIN
Deposited on 2006-05-23, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-130)
  Domains in SCOPe 2.06: d2h3va_
• Heterogens: PIO

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h3vA (A:)
  garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
  gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
  tgnnsqvsqny