PDB entry 2h3u

View 2h3u on RCSB PDB site
Description: Crystal structure of murine carnitine acetyltransferase in complex with carnitine and CoA
Class: transferase
Keywords: carnitine acyltransferase, TRANSFERASE
Deposited on 2006-05-23, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carnitine acetyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crat
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3V1Y3 (3-598)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2h3ua1, d2h3ua2, d2h3ua3
  • Chain 'B':
    Compound: carnitine acetyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crat
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3V1Y3 (3-598)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2h3ub1, d2h3ub2, d2h3ub3
  • Heterogens: COA, 152, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3uA (A:)
    shmahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkg
    lerrakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegv
    ldfksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvv
    hnyqffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnl
    ikdkvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdkt
    lqfivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnit
    peikndiekakqnlsimiqdldimmltfhhfgkdfpkseklspdafiqvalqlayyriyg
    qacatyesaslrmfhlgrtdtirsasidslafvkgmgdstvpeqqkvellrkavqahray
    tdrairgeafdrhllglklqaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmff
    gpvvpdgygicynpmeahinfsvsaynscaetnaarmahylekalldmrtllqnhprak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3uB (B:)
    shmahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkg
    lerrakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegv
    ldfksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvv
    hnyqffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnl
    ikdkvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdkt
    lqfivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnit
    peikndiekakqnlsimiqdldimmltfhhfgkdfpkseklspdafiqvalqlayyriyg
    qacatyesaslrmfhlgrtdtirsasidslafvkgmgdstvpeqqkvellrkavqahray
    tdrairgeafdrhllglklqaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvmff
    gpvvpdgygicynpmeahinfsvsaynscaetnaarmahylekalldmrtllqnhprak