PDB entry 2h3q

View 2h3q on RCSB PDB site
Description: Solution structure of HIV-1 myrMA bound to di-C4-phosphatidylinositol-(4,5)-bisphosphate
Class: viral protein
Keywords: HIV-1 myristoylated Matrix protein bound to di-C4-PI(4,5)P2, VIRAL PROTEIN
Deposited on 2006-05-22, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h3qa_
  • Heterogens: MYR, PBU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3qA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqny