PDB entry 2h3k

View 2h3k on RCSB PDB site
Description: Solution Structure of the first NEAT domain of IsdH
Class: protein binding
Keywords: NEAT domain, IsdH, HarA, PROTEIN BINDING
Deposited on 2006-05-22, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haptoglobin-binding surface anchored protein
    Species: Staphylococcus aureus [TaxId:282459]
    Gene: SA1552
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h3ka1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3kA (A:)
    adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
    veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
    dgeetnydytklvfakpiyndpsl